Cagrilinitide 10mg
Price range: $129.00 through $159.00
Cagrilintide is a high purity long acting amylin analogue research peptide, also known as AM833. AusBioLabs supplies it as a lyophilised powder with more than 99% HPLC purity. In addition, scientists study it in vitro at the amylin and calcitonin receptors. However, use it only for laboratory research. In short, it is not for human consumption, medical use, or veterinary use.
- Third-Party Batch Tested: Every batch is independently tested before release.
- Certificate of Analysis: Batch-specific lab reports are available on our website.
- Australia Post Express: Fast, tracked shipping across Australia.
Cagrilintide Australia – Long Acting Amylin Analogue Research Peptide | AusBioLabs
Buy Cagrilintide in Australia – Cagrilintide is a long acting amylin analogue peptide, also known as AM833. In fact, it acts on the amylin and calcitonin receptors. Because of this action, researchers study it in laboratory metabolic and receptor pharmacology work.
In the lab, scientists use Cagrilintide only for in vitro studies. For example, they examine receptor binding, cell signalling, and metabolic pathways. Overall, AusBioLabs supplies premium research grade Cagrilintide strictly for qualified laboratory work.
Key Highlights
- Purity: >99% (Third party HPLC & MS Tested)
- Form: Lyophilised Powder
- Intended Use: Strictly for in vitro laboratory research only. Not for human consumption.
- Shipping: Fast Sydney/Melbourne Dispatch via Australia Post Express
What Is Cagrilintide?
Cagrilintide is a modified amylin analogue. First, it copies the natural hormone amylin. Then, a fatty acid chain is added to make it last longer. As a result, labs use it to study amylin signalling over a longer window.
Researchers value Cagrilintide because it binds several receptors. Moreover, it acts on both amylin and calcitonin receptors in studies. In short, this makes it a useful tool in metabolic research.
Research Applications (In Vitro / Laboratory Only)
- Amylin Receptor Binding: First, researchers study how Cagrilintide binds the amylin receptor in cell models.
- Calcitonin Receptor Activity: In addition, scientists examine its action at the calcitonin receptor.
- Metabolic Research Models: Also, labs use it in vitro to probe energy and metabolic pathways.
- Receptor Pharmacology: Moreover, teams study how the acylation changes its receptor profile.
- Comparative Peptide Studies: Finally, Cagrilintide serves as a long acting benchmark amylin analogue.
Storage & Handling
- To begin, store the powder in a cool, dry place below 25°C, and keep it away from light.
- Additionally, for longer storage, store it at-20°C.
- Next, reconstitute with bacteriostatic water under sterile lab conditions.
- Finally, avoid repeated freeze thaw cycles.
Why Choose AusBioLabs Cagrilintide
- Premium research grade Cagrilintide (>99% purity)
- We test every batch by HPLC and MS, and we include a Certificate of Analysis (CoA)
- Discreet, temperature controlled shipping
- Free Express Shipping on orders over $200
- AU Owned & Operated, and trusted by thousands of researchers
Technical Specifications
| Attribute | Detail |
|---|---|
| Also Known As | AM833 |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Cys3-Cys8 disulfide bridge; N-terminal eicosanedioic acid γ-Glu acylation) |
| Amino Acids | 37 (modified, acylated) |
| Mechanism | Amylin (AMYR) and calcitonin (CTR) receptor agonist |
| Purity | >99% (HPLC) |
| Appearance | White Lyophilised Powder |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409.0 g/mol (approx.) |
| CAS No. | 1415456-99-3 |
| Form | Lyophilised Powder |
| Packaging | Sterile Vial |
Frequently Asked Questions
What do researchers use Cagrilintide for?
Scientists use Cagrilintide only for in vitro and laboratory studies. For example, they explore amylin and calcitonin receptor signalling, plus metabolic pathways in cell models. Above all, it is not for human or animal use.
What kind of peptide is Cagrilintide?
Cagrilintide is a long acting amylin analogue. In fact, it carries a fatty acid chain that slows its breakdown. Therefore, researchers use it to study amylin receptor signalling over an extended window.
How do I store and reconstitute Cagrilintide?
Cagrilintide ships as a lyophilised powder. First, in a sterile lab, researchers usually mix it with bacteriostatic water. Then store the powder below 25°C and away from light, or store it at-20°C for long-term storage. Finally, avoid repeated freeze thaw cycles.
Can I buy Cagrilintide in Australia for research?
Yes. AusBioLabs sells Cagrilintide only as a research chemical for qualified laboratory use. However, it is not approved for human, medical, veterinary, or household use. Therefore, the buyer takes full responsibility for safe and compliant handling.
Disclaimer: Use this product strictly for qualified laboratory research only. It is not for human consumption, medical, veterinary, or household use. The buyer takes full responsibility for proper handling and use.
5 reviews for Cagrilinitide 10mg
Clear filtersAt Ausbiolabs, we aim to deliver your order quickly, safely, and reliably. All orders are shipped from our Sydney/Melbourne locations via Australia Post Express for fast, tracked delivery.
Shipping Rates
- Free Express Shipping – Orders over $200 AUD
- Flat Rate Express Shipping – $14.95 AUD for orders under $200
Delivery Times
- Metro Areas: 2–4 business days
- Regional Areas: 3–5 business days
Delivery timeframes are estimates provided by Australia Post and may vary depending on your location and seasonal demand.
Dispatch Times
- Orders placed before 12:00 PM AEST are shipped the same business day
- Orders placed after 12:00 PM or on weekends/public holidays will be dispatched the next business day
Tracking Your Order
Once your order has been shipped, you will receive an email with your Australia Post tracking number. You can track your order via the Australia Post website.
International Shipping
We currently ship within Australia and New Zealand only.
Order Issues & Delays
If your order is delayed, lost, or arrives damaged, please contact us within 48 hours of delivery so we can investigate and arrange a replacement if eligible under our Quality Assurance Guarantee.
Intended Use:
This product is intended strictly for qualified laboratory researchers. It is not for human or veterinary consumption and must not be used as a drug, food additive, cosmetic, or household item.
Disclaimer:
This compound is sold for in vitro research and educational purposes only. It has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. All buyers must be authorized research personnel or institutions.
Terms of Sale:
By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. AUSBIOLABS and its affiliates are not liable for any misuse or mishandling of this material.
Hugo V. –
Fast shipping. Product sealed. Works well.
Ravi P. –
I’ve been on tirzepatide 15mg for 9 months and hit a wall – lost 58 pounds but then stopped completely for 3 months. Added cagrilintide 2.4mg weekly to my protocol. Within 2 weeks I started losing again. The combination of amylin and GLP-1/GIP is powerful – appetite is basically gone and I have to remind myself to eat protein.
Zachary R. –
works great. ships fast. no complaints.
Mateo G. –
Delivery was about 4 days. Product properly sealed and packaged. Using with semaglutide for about 5 weeks. Appetite suppression is stronger but I’m also more nauseous than I was on semaglutide alone.
Desmond W. –
Shipping took about 6 days. Product in good shape. Using it with tirzepatide. Appetite is definitely more suppressed but honestly the nausea is pretty intense.