LL37 5mg

Price range: $89.00 through $119.00

LL-37 is a high-purity cathelicidin antimicrobial research peptide, the only human cathelicidin. AusBioLabs supplies it as a lyophilised powder with more than 99% HPLC purity. In addition, scientists study it in vitro for antimicrobial activity, immune signalling, and wound repair. However, use it only for laboratory research. In short, it is not for human consumption, medical use, or veterinary use.

  • Third-Party Batch Tested: Every batch is independently tested before release.
  • Certificate of Analysis: Batch-specific lab reports are available on our website.
  • Australia Post Express: Fast, tracked shipping across Australia.
Earn up to 60 points.
✦ Volume Savings
Buy 2
$84.55 / each
−5%
Buy 3
$80.10 / each
−10%
Buy 4 or more
$75.65 / each
−15%
Description

LL-37 Australia – Cathelicidin Antimicrobial Research Peptide | AusBioLabs

Buy LL-37 in Australia – LL-37 is a natural antimicrobial peptide, and the only human cathelicidin. In fact, it is a 37 amino acid peptide that helps the body fight microbes. Because of this role, researchers study it in laboratory work on host defence and immune pathways.

In the lab, scientists use LL-37 only for in vitro studies. For example, they examine antimicrobial activity, immune signalling, and wound repair cells. Overall, AusBioLabs supplies premium research grade LL-37 strictly for qualified laboratory work.

Key Highlights

  • Purity: >99% (Third party HPLC & MS Tested)
  • Form: Lyophilised Powder
  • Intended Use: Strictly for in vitro laboratory research only. Not for human consumption.
  • Shipping: Fast Sydney/Melbourne Dispatch via Australia Post Express

What Is LL-37?

LL-37 is a cathelicidin peptide, which means it comes from a host defence protein. First, the body makes it from a larger protein called hCAP18. Then, it folds into a helix that targets microbes. As a result, labs use it to study antimicrobial pathways in cell models.

Researchers value LL-37 because it links to both defence and repair. Moreover, in studies it appears to affect immune cells and wound models. In short, this makes it a key tool in immune and antimicrobial research.

Research Applications (In Vitro / Laboratory Only)

  • Antimicrobial Research: First, researchers study how LL-37 acts against bacteria in culture.
  • Immune Signalling: In addition, scientists examine its role in immune cell pathways.
  • Wound Repair Models: Also, labs explore its part in wound and repair cell models.
  • Membrane Interaction: Moreover, teams study how it interacts with cell membranes in vitro.
  • Comparative Peptide Studies: Finally, LL-37 serves as a benchmark antimicrobial peptide.

Storage & Handling

  • To begin, store the powder in a cool, dry place below 25°C, and keep it away from light.
  • Additionally, for longer storage, store it at-20°C.
  • Next, reconstitute with sterile or bacteriostatic water under sterile lab conditions.
  • Finally, avoid repeated freeze thaw cycles.

Why Choose AusBioLabs LL-37

  • Premium research grade LL-37 (>99% purity)
  • We test every batch by HPLC and MS, and we include a Certificate of Analysis (CoA)
  • Discreet, temperature controlled shipping
  • Free Express Shipping on orders over $200
  • AU Owned & Operated, and trusted by thousands of researchers

Technical Specifications

Attribute Detail
Also Known As Cathelicidin, hCAP18 (fragment), Ropocamptide
Sequence [LL-37, 37 aa]
Amino Acids 37
Mechanism Cathelicidin antimicrobial and immune peptide
Purity >99% (HPLC)
Appearance White Lyophilised Powder
Molecular Formula C205H340N60O53
Molecular Weight 4493.3 g/mol (approx.)
CAS No. 154947-66-7
Form Lyophilised Powder
Packaging Sterile Vial

Frequently Asked Questions

What do researchers use LL-37 for?

Scientists use LL-37 only for in vitro and laboratory studies. For example, they explore antimicrobial activity, immune signalling, and wound repair in cell models. Above all, it is not for human or animal use.

How pure is AusBioLabs LL-37?

First, we test every batch to more than 99% purity by HPLC. In addition, we confirm each result by mass spectrometry. We also provide a Certificate of Analysis (CoA) for every lot.

How do I store and reconstitute LL-37?

LL-37 ships as a lyophilised powder. First, in a sterile lab, researchers usually mix it with sterile or bacteriostatic water. Then store the powder below 25°C and away from light, or store it at-20°C for long-term storage. Finally, avoid repeated freeze thaw cycles.

Can I buy LL-37 in Australia for research?

Yes. AusBioLabs sells LL-37 only as a research chemical for qualified laboratory use. However, it is not approved for human, medical, veterinary, or household use. Therefore, the buyer takes full responsibility for safe and compliant handling.

Disclaimer: Use this product strictly for qualified laboratory research only. It is not for human consumption, medical, veterinary, or household use. The buyer takes full responsibility for proper handling and use.

Reviews (0)
0 reviews
0
0
0
0
0

There are no reviews yet.

Be the first to review “LL37 5mg”

Your email address will not be published. Required fields are marked *

The maximum file size is 1 MB and you can upload up to 2 images.

You have to be logged in to be able to add photos to your review.

Shipping Policy

At Ausbiolabs, we aim to deliver your order quickly, safely, and reliably. All orders are shipped from our Sydney/Melbourne locations via Australia Post Express for fast, tracked delivery.

Shipping Rates

  • Free Express Shipping – Orders over $200 AUD
  • Flat Rate Express Shipping – $14.95 AUD for orders under $200

Delivery Times

  • Metro Areas: 2–4 business days
  • Regional Areas: 3–5 business days

Delivery timeframes are estimates provided by Australia Post and may vary depending on your location and seasonal demand.

Dispatch Times

  • Orders placed before 12:00 PM AEST are shipped the same business day
  • Orders placed after 12:00 PM or on weekends/public holidays will be dispatched the next business day

Tracking Your Order

Once your order has been shipped, you will receive an email with your Australia Post tracking number. You can track your order via the Australia Post website.

International Shipping

We currently ship within Australia and New Zealand only.

Order Issues & Delays

If your order is delayed, lost, or arrives damaged, please contact us within 48 hours of delivery so we can investigate and arrange a replacement if eligible under our Quality Assurance Guarantee.

Compliance

Intended Use:
This product is intended strictly for qualified laboratory researchers. It is not for human or veterinary consumption and must not be used as a drug, food additive, cosmetic, or household item.

Disclaimer:
This compound is sold for in vitro research and educational purposes only. It has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. All buyers must be authorized research personnel or institutions.

Terms of Sale:
By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. AUSBIOLABS and its affiliates are not liable for any misuse or mishandling of this material.

RELATED PRODUCTS